Integrin Alpha2b antibody
-
- Target See all Integrin Alpha2b (CD41) Antibodies
- Integrin Alpha2b (CD41)
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Integrin Alpha2b antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity
- Immunogen
- Amino acids EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN of human ITGA2B/CD41 were used as the immunogen for the CD41 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product CD41 Primary Antibody
-
anti-Integrin Alpha2b (CD41) (AA 45-149) antibody
CD41 Reactivity: Human FACS, WB, ELISA, IHC Host: Mouse Monoclonal 2E10C9 unconjugated
anti-Integrin Alpha2b (CD41) (AA 351-450) antibodyCD41 Reactivity: Human, Rat FACS, WB, ELISA, IHC (fro), IHC (p), IF (cc), IF (p) Host: Rabbit Polyclonal unconjugated
anti-Integrin Alpha2b (CD41) (Internal Region) antibodyCD41 Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Integrin Alpha2b (CD41) antibodyCD41 Reactivity: Mouse FACS, ELISA, IHC (fro), IP, IHC (p), Func Host: Rat Monoclonal MWReg30 unconjugated
anti-Integrin Alpha2b (CD41) antibodyCD41 Reactivity: Mouse FACS, ELISA, IHC (fro), IP, IHC (p) Host: Rat Monoclonal MWReg30 unconjugated
anti-Integrin Alpha2b (CD41) antibodyCD41 Reactivity: Human, Non-Human Primate FACS, IHC (fro) Host: Mouse Monoclonal HIP2 unconjugated
anti-Integrin Alpha2b (CD41) antibody (Biotin)CD41 Reactivity: Human FACS Host: Mouse Monoclonal MEM-06 Biotin
anti-Integrin Alpha2b (CD41) antibody (FITC)CD41 Reactivity: Human FACS Host: Mouse Monoclonal MEM-06 FITC
anti-Integrin Alpha2b (CD41) (AA 677-711), (C-Term) antibodyCD41 Reactivity: Human, Mouse, Rat WB, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Integrin Alpha2b (CD41) (AA 639-887) antibodyCD41 Reactivity: Human ELISA, IHC, IF Host: Rabbit Polyclonal unconjugated
-
- Application Notes
- Optimal dilution of the CD41 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the CD41 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- Integrin Alpha2b (CD41)
- Alternative Name
- CD41 / ITGA2B (CD41 Products)
- Synonyms
- AI172977 antibody, CD41 antibody, CD41B antibody, GpIIb antibody, alphaIIb antibody, BDPLT16 antibody, BDPLT2 antibody, GP2B antibody, GPIIb antibody, GT antibody, GTA antibody, HPA3 antibody, integrin alpha 2b antibody, integrin subunit alpha 2b antibody, Itga2b antibody, ITGA2B antibody
- Background
- Integrin alpha-IIb is a protein that in humans is encoded by the ITGA2B gene. It is mapped to 17q21.32. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibrinogen receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell-surface mediated signalling.
- UniProt
- P08514
- Pathways
- Integrin Complex
-
