CRY2 antibody

Catalog No. ABIN4950666

Product Details anti-CRY2 Antibody

Target: CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRY2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids RFQAIISRMELPKKPVGLVTSQQMESCRAE of human CRY2 were used as the immunogen for the CRY2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the CRY2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the CRY2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for CRY2

Target: CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))

Alternative Name: CRY2 (CRY2 Products)

Synonyms: Cry2 antibody, Cry antibody, GB10211 antibody, CRY2 antibody, AT-PHH1 antibody, ATCRY2 antibody, CRYPTOCHROME 2 APOPROTEIN antibody, F19P19.14 antibody, F19P19_14 antibody, FHA antibody, PHH1 antibody, cryptochrome 2 antibody, HCRY2 antibody, PHLL2 antibody, AV006279 antibody, D130054K12Rik antibody, gCry2 antibody, cryptochrome circadian regulator 2 antibody, cryptochrome 2 antibody, cryptochrome Cry2 antibody, cryptochrome circadian clock 2 antibody, cryptochrome 2 (photolyase-like) antibody, CRY2 antibody, Cry2 antibody, cry2 antibody, LOC100502533 antibody

Background: This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. And it is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Two transcript variants encoding different isoforms have been found for this gene.

UniProt: Q49AN0

Pathways: Response to Water Deprivation, Protein targeting to Nucleus