ERV3 antibody

Catalog No. ABIN4950951

Product Details anti-ERV3 Antibody

Target: ERV3 (ERV3-1) (Endogenous Retrovirus Group 3, Member 1 (ERV3-1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERV3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids LELDDEGKVIKEITAKIQKLAHIPVQTWKG of human ERV3 were used as the immunogen for the ERV3 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the ERV3 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ERV3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ERV3

Target: ERV3 (ERV3-1) (Endogenous Retrovirus Group 3, Member 1 (ERV3-1))

Alternative Name: ERV3 / ERV3-1 (ERV3-1 Products)

Synonyms: ERV-R antibody, ERV3 antibody, ERVR antibody, HERV-R antibody, HERVR antibody, envR antibody, endogenous retrovirus group 3 member 1, envelope antibody, ERV3-1 antibody

Background: HERV-R_7q21.2 provirus ancestral Env polyprotein, also known as ERV3-1, is a protein that in humans is encoded by the ERV3 gene. By radiation hybrid analysis, the ERV3 gene is mapped to chromosome 7q11.2. The human genome includes many retroelements including the human endogenous retroviruses (HERVs). ERV3, one of the most studied HERVs, is thought to have integrated 30 to 40 million years ago and is present in higher primates with the exception of gorillas. Taken together, the observation of genome conservation, the detection of transcript expression, and the presence of conserved ORFs is circumstantial evidence for a functional role. A functional role is also suggested by the observation that downregulation of ERV3 is reported in choriocarcinoma.

UniProt: Q14264