FABP2 (Intestinal) antibody
Reactivity: Human, Mouse, Rat
IHC (p), WB
Host: Rabbit
Polyclonal
unconjugated
-
- Target
- FABP2 (Intestinal)
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Clonality
- Polyclonal
- Application
- Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
- Purification
- Antigen affinity
- Immunogen
- Amino acids AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLK from the human protein were used as the immunogen for the FABP2 antibody.
- Isotype
- IgG
-
- Application Notes
- Optimal dilution of the FABP2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (FFPE): 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the FABP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- FABP2 (Intestinal)
- Background
- FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor. [UniProt]
- UniProt
- P12104
-
You are here:
