FE65 antibody

Catalog No. ABIN4951012

Product Details anti-FE65 Antibody

Target: FE65 (APBB1) (Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 (Fe65) (APBB1))

Reactivity: Mouse, Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FE65 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids ALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGE of human FE65 were used as the immunogen for the FE65 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the FE65 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the FE65 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for FE65

Target: FE65 (APBB1) (Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 (Fe65) (APBB1))

Alternative Name: FE65 (APBB1 Products)

Synonyms: FE65 antibody, MGC:9072 antibody, RIR antibody, apbb1 antibody, MGC80654 antibody, Fe65 antibody, Rir antibody, amyloid beta precursor protein binding family B member 1 antibody, amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) L homeolog antibody, amyloid beta (A4) precursor protein-binding, family B, member 1 antibody, APBB1 antibody, apbb1.L antibody, Apbb1 antibody

Background: APBB1/RIR/FE65 is a transcription coregulator that can have both coactivator and corepressor functions. Adapter protein that forms a transcriptionally active complex with the gamma-secretase-derived amyloid precursor protein (APP) intracellular domain. Plays a central role in the response to DNA damage by translocating to the nucleus and inducing apoptosis. May act by specifically recognizing and binding histone H2AX phosphorylated on 'Tyr-142' (H2AXY142ph) at double-strand breaks (DSBs), recruiting other pro-apoptosis factors such as MAPK8/JNK1. Required for histone H4 acetylation at double-strand breaks (DSBs). Its ability to specifically bind modified histones and chromatin modifying enzymes such as KAT5/TIP60, probably explains its trancription activation activity. Function in association with TSHZ3, SET and HDAC factors as a transcriptional repressor, that inhibits the expression of CASP4. Associates with chromatin in a region surrounding the CASP4 transcriptional start site(s). encoding different isoforms have been described for this gene.

UniProt: O00213

Pathways: Positive Regulation of Response to DNA Damage Stimulus