FMR1 antibody

Catalog No. ABIN4951062

Product Details anti-FMR1 Antibody

Target: FMR1 (Fragile X Mental Retardation 1 (FMR1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FMR1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM of human FMRP were used as the immunogen for the FMRP antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the FMRP antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the FMRP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for FMR1

Target: FMR1 (Fragile X Mental Retardation 1 (FMR1))

Alternative Name: FMRP / FMR1 (FMR1 Products)

Synonyms: AT24755 antibody, BcDNA:GM08679 antibody, CG6203 antibody, Dmel\\CG6203 antibody, EP(3)3517 antibody, FMR antibody, FMR1 antibody, FMRP antibody, FMRp antibody, FXR antibody, Fmrp antibody, cg6203 antibody, dFMR antibody, dFMR1 antibody, dFMRP antibody, dFXR antibody, dFXR1 antibody, dFXRP antibody, dFmr1 antibody, dFmrp antibody, dfmr antibody, dfmr1 antibody, dfxr antibody, dfxr1 antibody, dmfr1 antibody, fmr antibody, fmr1 antibody, FRAXA antibody, POF antibody, POF1 antibody, zFMR1 antibody, Fmr-1 antibody, CG6203 gene product from transcript CG6203-RC antibody, fragile X mental retardation 1 antibody, fragile X mental retardation syndrome 1 antibody, Fmr1 antibody, FMR1 antibody, fmr1 antibody

Background: FMR1 (fragile X mental retardation 1) is a human gene that codes for a protein called fragile X mental retardation protein, or FMRP. This protein, most commonly found in the brain, is essential for normalcognitive developmentand female reproductive function. Mutations of this gene can lead to fragile X syndrome, mental retardation, premature ovarian failure, autism, Parkinson's disease, developmental delays and other cognitive deficits. The protein encoded by this gene binds RNA and is associated with polysomes. Additionally, the encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1). Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene.

UniProt: Q06787

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development