FUT1 antibody

Catalog No. ABIN4951103

Product Details anti-FUT1 Antibody

Target: FUT1 (Fucosyltransferase 1 (Galactoside 2-alpha-L-Fucosyltransferase, H Blood Group) (FUT1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FUT1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids EVDSRTPWRELQLHDWMSEEYADLRDPFLKL of human FUT1 were used as the immunogen for the FUT1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the FUT1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the FUT1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for FUT1

Target: FUT1 (Fucosyltransferase 1 (Galactoside 2-alpha-L-Fucosyltransferase, H Blood Group) (FUT1))

Alternative Name: FUT1 (FUT1 Products)

Synonyms: Futa antibody, H antibody, HH antibody, HSC antibody, Fut1 antibody, fucosyltransferase 1 antibody, fucosyltransferase 1 (H blood group) antibody, Fut1 antibody, FUT1 antibody

Background: Galactoside 2-alpha-L-fucosyltransferase 1 is an enzyme that in humans is encoded by the FUT1 gene. It is mapped to 19q13.3. The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.

UniProt: P19526