GAL4 antibody

Catalog No. ABIN4951128

Product Details anti-GAL4 Antibody

Target: GAL4 (LGALS4) (Galectin 4 (LGALS4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GAL4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY were used as the immunogen for the GAL4 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the GAL4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the GAL4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for GAL4

Target: GAL4 (LGALS4) (Galectin 4 (LGALS4))

Alternative Name: GAL4 / Galectin-4 (LGALS4 Products)

Synonyms: LGALS4 antibody, gal4 antibody, l36lbp antibody, MGC86186 antibody, galectin-4 antibody, xgalectin-VIa antibody, gal-4 antibody, L36LBP antibody, L-36 antibody, L36LBI antibody, GAL4 antibody, galectin 4 antibody, lectin, galactoside-binding, soluble, 4 L homeolog antibody, Galectin-4 antibody, lectin, galactose binding, soluble 4 antibody, LGALS4 antibody, lgals4.L antibody, leg4 antibody, Lgals4 antibody

Background: Galectin-4 is a protein that in humans is encoded by the LGALS4 gene. This gene is mapped to chromosome 19q13.2 based on an alignment of the LGALS4 sequence. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer. The 323-amino acid LGALS4 protein contains 2 homologous, approximately 150-amino acid carbohydrate recognition domains and all amino acids typically conserved in galectins.

UniProt: P56470