Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

GREM1 antibody

GREM1 Reactivity: Human, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN4951242
  • Target See all GREM1 Antibodies
    GREM1 (Gremlin 1 (GREM1))
    Reactivity
    • 73
    • 40
    • 23
    • 5
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    Human, Rat
    Host
    • 79
    • 8
    • 1
    Rabbit
    Clonality
    • 80
    • 8
    Polyclonal
    Conjugate
    • 38
    • 14
    • 11
    • 6
    • 4
    • 4
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This GREM1 antibody is un-conjugated
    Application
    • 80
    • 45
    • 31
    • 13
    • 13
    • 9
    • 7
    • 5
    • 3
    • 3
    • 3
    • 2
    • 2
    Western Blotting (WB)
    Purification
    Antigen affinity
    Immunogen
    Amino acids TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD of human Gremlin 1 were used as the immunogen for the Gremlin 1 antibody.
    Isotype
    IgG
    Top Product
    Discover our top product GREM1 Primary Antibody
  • Application Notes
    Optimal dilution of the Gremlin 1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
    Restrictions
    For Research Use only
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Storage
    -20 °C
    Storage Comment
    After reconstitution, the Gremlin 1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target
    GREM1 (Gremlin 1 (GREM1))
    Alternative Name
    Gremlin 1 (GREM1 Products)
    Synonyms
    grem1 antibody, MGC136702 antibody, zgc:136702 antibody, GREM1 antibody, drm antibody, pig2 antibody, dand2 antibody, ihg-2 antibody, gremlin antibody, Cktsf1b1 antibody, Drm antibody, Grem antibody, ld antibody, gremlin-1 antibody, CKTSF1B1 antibody, DAND2 antibody, DRM antibody, GREMLIN antibody, IHG-2 antibody, cktsf1b1 antibody, gremlin 1a, DAN family BMP antagonist antibody, gremlin 1, DAN family BMP antagonist antibody, gremlin 1 antibody, gremlin 1, DAN family BMP antagonist L homeolog antibody, grem1a antibody, GREM1 antibody, LOC662541 antibody, grem1 antibody, Grem1 antibody, grem1.L antibody
    Background
    Gremlin, also known as Drm, is a highly conserved 20.7- kDa, 184 amino acid glycoprotein part of the DAN family and is a cysteine knot-secreted protein. Skeletal cells synthesize bone morphogenetic proteins (BMPs) and BMP antagonists. And Gremlin is expressed in osteoblasts and opposes BMP effects on osteoblastic differentiation and function in vitro. Gremlin 1 (GREM 1) is known for its antagonistic reaction with BMPs in the TGF beta signaling pathway. This gene inhibits BMP-2, BMP-4, and BMP-7. Inhibition by grem 1 of BMPs in mice allow the expression of fibroblast growth factors (FGFs) 4 and 8 and Sonic hedgehog (SHH) which are necessary for proper limb development. Gremlin 1 may play an oncogenic role especially in carcinomas of the uterine cervix, lung, ovary, kidney, breast, colon, pancreas, and sarcoma. Over-expressed gremlin 1 functions by interaction with YWHAH (Its binding site for gremlin 1 was located between residues 61-80 and gremlin 1 binding site for YWHAH was found to be located between residues 1-67). Therefore, Gremlin 1 and its binding protein YWHAH could be good targets for developing diagnostic and therapeutic strategies against human cancers.
    UniProt
    O60565
    Pathways
    Regulation of Muscle Cell Differentiation, Tube Formation, Maintenance of Protein Location
You are here:
Support