GRK5 antibody

Catalog No. ABIN4951249

Product Details anti-GRK5 Antibody

Target: GRK5 (G Protein-Coupled Receptor Kinase 5 (GRK5))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GRK5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK of human GRK5 were used as the immunogen for the GRK5 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the GRK5 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the GRK5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for GRK5

Target: GRK5 (G Protein-Coupled Receptor Kinase 5 (GRK5))

Alternative Name: GRK5 (GRK5 Products)

Synonyms: GPRK5 antibody, Gprk5 antibody, si:dkey-171l20.1 antibody, GRK5 antibody, DKFZp468J1119 antibody, grk5 antibody, G protein-coupled receptor kinase 5 antibody, G protein-coupled receptor kinase 5 L homeolog antibody, GRK5 antibody, Grk5 antibody, grk5 antibody, grk5.L antibody

Background: G protein-coupled receptor kinase 5 is an enzyme that in humans is encoded by the GRK5 gene. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).

UniProt: P34947

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling