Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

HSPA9 antibody

HSPA9 Reactivity: Human, Rat, Mouse WB, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN4951254
  • Target See all HSPA9 Antibodies
    HSPA9 (Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9))
    Reactivity
    • 78
    • 41
    • 26
    • 7
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Human, Rat, Mouse
    Host
    • 72
    • 7
    Rabbit
    Clonality
    • 73
    • 6
    Polyclonal
    Conjugate
    • 39
    • 6
    • 6
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This HSPA9 antibody is un-conjugated
    Application
    • 60
    • 28
    • 24
    • 18
    • 13
    • 13
    • 8
    • 7
    • 6
    • 5
    • 4
    • 4
    • 2
    • 2
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purification
    Antigen affinity
    Immunogen
    Amino acids KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ of human HSPA9/GRP75 were used as the immunogen for the GRP75 antibody.
    Isotype
    IgG
    Top Product
    Discover our top product HSPA9 Primary Antibody
  • Application Notes
    Optimal dilution of the GRP75 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
    Restrictions
    For Research Use only
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Storage
    -20 °C
    Storage Comment
    After reconstitution, the GRP75 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target
    HSPA9 (Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9))
    Alternative Name
    GRP75 (HSPA9 Products)
    Synonyms
    APG-2 antibody, HS24/P52 antibody, HSPH2 antibody, RY antibody, hsp70 antibody, hsp70RY antibody, CSA antibody, GRP-75 antibody, GRP75 antibody, HSPA9B antibody, MOT antibody, MOT2 antibody, MTHSP75 antibody, PBP74 antibody, Hspa9a antibody, csa antibody, grp-75 antibody, grp75 antibody, hspa9 antibody, hspa9b antibody, mortalin antibody, mot antibody, mot2 antibody, pbp74 antibody, mot-2 antibody, mthsp75 antibody, 74kDa antibody, Csa antibody, Grp75 antibody, Hsc74 antibody, Hsp74 antibody, Hsp74a antibody, Mortalin antibody, Mot-2 antibody, Mot2 antibody, Mthsp70 antibody, Pbp74 antibody, cb740 antibody, crs antibody, wu:fc14d08 antibody, wu:fc27c10 antibody, wu:fc38a06 antibody, heat shock protein family A (Hsp70) member 4 antibody, heat shock protein family A (Hsp70) member 9 antibody, heat shock protein family A member 9 antibody, heat shock protein family A (Hsp70) member 9 S homeolog antibody, stress-70 protein, mitochondrial antibody, heat shock protein 9 antibody, heat shock protein Hsp9 antibody, HSPA4 antibody, HSPA9 antibody, Hspa9 antibody, hspa9.S antibody, hspa9 antibody, LOC577721 antibody, hsp9 antibody
    Background
    HSPA9 (heat shock 70 kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.
    UniProt
    P38646
You are here:
Support