HDAC6 antibody

Catalog No. ABIN4951283

Product Details anti-HDAC6 Antibody

Target: HDAC6 (Histone Deacetylase 6 (HDAC6))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HDAC6 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids EKEELMLVHSLEYIDLMETTQYMNEGELRVLAD of human HDAC6 were used as the immunogen for the HDAC6 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the HDAC6 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the HDAC6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for HDAC6

Target: HDAC6 (Histone Deacetylase 6 (HDAC6))

Alternative Name: HDAC6 (HDAC6 Products)

Synonyms: HD6 antibody, Hd6 antibody, Hdac5 antibody, Sfc6 antibody, mHDA2 antibody, CG6170 antibody, DHDAC2 antibody, DmHDAC2 antibody, Dmel\\CG6170 antibody, HDAC antibody, HDAC2 antibody, dHDAC2 antibody, dHDAC6 antibody, dmHDA404 antibody, hdac6 antibody, MGC53140 antibody, wu:fc31d02 antibody, dsim_GLEANR_17355 antibody, DsimGD17207 antibody, GD17207 antibody, HDAC6 antibody, ATHDA6 antibody, AXE1 antibody, HISTONE DEACETYLASE 6 antibody, MDC12.7 antibody, MDC12_7 antibody, RNA-MEDIATED TRANSCRIPTIONAL SILENCING 1 antibody, RPD3B antibody, RTS1 antibody, SIL1 antibody, histone deacetylase 6 antibody, histone deacetylase 6 antibody, Histone deacetylase 6 antibody, histone deacetylase 6 L homeolog antibody, GD17207 gene product from transcript GD17207-RB antibody, Histone DeAcetylase antibody, HDAC6 antibody, Hdac6 antibody, hdac6.L antibody, hdac6 antibody, Dsim\HDAC6 antibody, PTRG_03035 antibody, HDA6 antibody, hda-6 antibody

Background: HDAC6, also called KIAA0901, is a member belongs to class II of the histone deacetylase/acuc/apha family of proteins that is an enzyme that in humans is encoded by the HDAC6 gene. The HDAC6 gene is mapped to chromosome Xp11.23. HDAC6 contains an internal duplication of two catalytic domains which appear to function independently of each other. The protein possesses histone deacetylase activity and represses transcription. HDAC6 functions as a tubulin deacetylase. And it is localized exclusively in the cytoplasm, where it associates with microtubules and localizes with the microtubule motor complex. HDAC6 could bind both polyubiquitinated misfolded proteins and dynein motors, thereby recruiting misfolded protein cargo to dynein motors for transport to aggresomes. Furthermore, expression of HDAC6 was sufficient to rescue degeneration associated with UPS dysfunction in vivo in an autophagy-dependent manner. HDAC6 is a central component of the stress response that regulates SG formation and potentially contributes to control of RNA metabolism and translation.

UniProt: Q9UBN7

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling