HMGB3 antibody
-
- Target See all HMGB3 Antibodies
- HMGB3 (High Mobility Group Box 3 (HMGB3))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HMGB3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity
- Immunogen
- Amino acids EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR of human HMG4 were used as the immunogen for the HMG4 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product HMGB3 Primary Antibody
-
-
- Application Notes
- Optimal dilution of the HMG4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the HMG4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- HMGB3 (High Mobility Group Box 3 (HMGB3))
- Alternative Name
- HMGB3 / HMG4 (HMGB3 Products)
- Synonyms
- HMG-2a antibody, HMG-4 antibody, HMG2A antibody, HMG4 antibody, Hmg2a antibody, Hmg4 antibody, RGD1564407 antibody, hmgb3 antibody, MGC54022 antibody, Xhmgb3 antibody, MGC88931 antibody, fa19b06 antibody, fj43d02 antibody, wu:fa19b06 antibody, wu:fj43d02 antibody, zgc:112073 antibody, HMGB3 antibody, NFD03 antibody, NFD3 antibody, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR antibody, high mobility group B3 antibody, HMG-1 antibody, HMG2a antibody, HMGB1 antibody, high mobility group box 3 antibody, high mobility group box 3b antibody, high mobility group box 3 S homeolog antibody, high mobility group protein antibody, high mobility group B3 antibody, High mobility group protein B3 antibody, HMGB3 antibody, Hmgb3 antibody, hmgb3 antibody, hmgb3b antibody, hmgb3.S antibody
- Background
- High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.
- UniProt
- O15347
-