HNF1B antibody
-
- Target See all HNF1B Antibodies
- HNF1B (HNF1 Homeobox B (HNF1B))
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HNF1B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity
- Immunogen
- Amino acids AQQPFMAAVTQLQNSHMYAHKQEPPQYSHT of human HNF1 beta were used as the immunogen for the HNF1 beta antibody.
- Isotype
- IgG
- Top Product
- Discover our top product HNF1B Primary Antibody
-
-
- Application Notes
- Optimal dilution of the HNF1 beta antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the HNF1 beta antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- HNF1B (HNF1 Homeobox B (HNF1B))
- Alternative Name
- HNF1B (HNF1B Products)
- Synonyms
- FJHN antibody, HNF-1B antibody, HNF1beta antibody, HNF2 antibody, HPC11 antibody, LF-B3 antibody, LFB3 antibody, MODY5 antibody, TCF-2 antibody, TCF2 antibody, VHNF1 antibody, HNF-1b antibody, HNF1B antibody, AI385728 antibody, AI987804 antibody, HNF-1Beta antibody, Hnf1beta antibody, Tcf-2 antibody, Tcf2 antibody, vHNF1 antibody, vHNF-1 antibody, chunp6877 antibody, hnf1b antibody, mst antibody, tcf2 antibody, vhnf1 antibody, lfb3 antibody, hnf-1beta antibody, hnf1-beta antibody, hnf1beta antibody, HNF1g antibody, wu:fc23f06 antibody, HNF1 homeobox B antibody, HNF1 homeobox Ba antibody, HNF1 homeobox B S homeolog antibody, HNF1 homeobox B L homeolog antibody, HNF1 homeobox Bb antibody, HNF1B antibody, Hnf1b antibody, hnf1ba antibody, hnf1b.S antibody, hnf1b.L antibody, hnf1bb antibody
- Background
- HNF1 homeobox B (hepatocyte nuclear factor 1 homeobox B), also known as HNF1B or transcription factor 2 (TCF2), is a human gene. It is a member of the homeodomain-containing superfamily of transcription factors. This gene is mapped to 17q12. The HNF1B protein is believed to form heterodimers with another liver-specific member of this transcription factor family, TCF1. HNF1B functions as both a classic transcriptional activator and as a bookmarking factor that marks target genes for rapid transcriptional reactivation after mitosis. HNF1B also can regulate renal tubulogenesis by controlling expression of SOC3. Mutation of HNF1B that disrupts normal function has been identified as the cause of MODY5 (Maturity-Onset of Diabetes, Type 5).
- UniProt
- P35680
- Pathways
- Hormone Transport, Stem Cell Maintenance, Tube Formation
-