IDO antibody

Catalog No. ABIN4951410

Product Details anti-IDO Antibody

Target: IDO (Indoleamine 2,3-Dioxygenase (IDO))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IDO antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH of human IDO1 were used as the immunogen for the IDO1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the IDO1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the IDO1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for IDO

Target: IDO (Indoleamine 2,3-Dioxygenase (IDO))

Alternative Name: IDO1 / Indoleamine 2, 3-dioxygenase (IDO Products)

Synonyms: IDO antibody, IDO-1 antibody, INDO antibody, Ido antibody, Indo antibody, indoleamine 2,3-dioxygenase 1 antibody, IDO1 antibody, Ido1 antibody

Background: IDO1 (INDOLEAMINE 2,3-DIOXYGENASE), INDO or IDO, is an immunomodulatory enzyme produced by some alternatively activated macrophages and other immunoregulatory cells. This enzyme catalyzes the degradation of the essential amino acid L-tryptophan to N-formyl-kynurenine. By fluorescence in situ hybridization, the assignment is narrowed to chromosome 8p12-p11. INDO Interferon-gamma has an antiproliferative effect on many tumor cells and inhibits intracellular pathogens such as Toxoplasma and chlamydia, at least partly because of the induction of indoleamine 2,3-dioxygenase. During inflammation, IDO is upregulated in dendritic cells and phagocytes by proinflammatory stimuli, most notably IFNG, and the enzyme then uses superoxide as a 'cofactor' for oxidative cleavage of the indole ring of tryptophan, yielding an intermediate that deformylates to L-kynurenine.

UniProt: P14902