IGFBP3 antibody

Catalog No. ABIN4951427

Product Details anti-IGFBP3 Antibody

Target: IGFBP3 (Insulin-Like Growth Factor Binding Protein 3 (IGFBP3))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IGFBP3 antibody is un-conjugated

Application: Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR of human IGFBP3 were used as the immunogen for the IGFBP3 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the IGFBP3 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the IGFBP3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for IGFBP3

Target: IGFBP3 (Insulin-Like Growth Factor Binding Protein 3 (IGFBP3))

Alternative Name: IGFBP3 (IGFBP3 Products)

Synonyms: BP-53 antibody, IBP3 antibody, AI649005 antibody, IGFBP-3 antibody, IGgfbp3 antibody, IGF-BP3 antibody, zgc:91788 antibody, IGFBP3 antibody, igfbp3 antibody, insulin like growth factor binding protein 3 antibody, insulin-like growth factor binding protein 3 antibody, IGFBP3 antibody, Igfbp3 antibody, igfbp3 antibody, IGFBP-3 antibody, LOC100305016 antibody

Background: IGFBP3, Insulin-like growth fator-binding protein 3, is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. IGFBP3 is located on chromosome 7. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

UniProt: P17936

Pathways: Myometrial Relaxation and Contraction, Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development, Regulation of Carbohydrate Metabolic Process, Autophagy, Smooth Muscle Cell Migration, Growth Factor Binding