IRF2 antibody

Catalog No. ABIN4951480

Product Details anti-IRF2 Antibody

Target: IRF2 (Interferon Regulatory Factor 2 (IRF2))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IRF2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids MTPASSSSRPDRETRASVIKKTSDITQARVKS of human IRF2 were used as the immunogen for the IRF2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the IRF2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the IRF2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for IRF2

Target: IRF2 (Interferon Regulatory Factor 2 (IRF2))

Alternative Name: IRF2 (IRF2 Products)

Synonyms: IRF-2 antibody, 9830146E22Rik antibody, AI646973 antibody, Irf-2 antibody, irf2b antibody, zgc:103451 antibody, irf-2 antibody, wu:fc74h04 antibody, zgc:76951 antibody, interferon regulatory factor 2 antibody, interferon regulatory factor 2 L homeolog antibody, interferon regulatory factor 2a antibody, IRF2 antibody, Irf2 antibody, irf2 antibody, irf2.L antibody, irf2a antibody

Background: Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and represses those genes. Also acts as an activator for several genes including H4 and IL7. Constitutively binds to the ISRE promoter to activate IL7. Involved in cell cycle regulation through binding the site II (HiNF-M) promoter region of H4 and activating transcription during cell growth. Antagonizes IRF1 transcriptional activation. [UniProt]

UniProt: P14316