IRF5 antibody

Catalog No. ABIN4951486

Product Details anti-IRF5 Antibody

Target: IRF5 (Interferon Regulatory Factor 5 (IRF5))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IRF5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ of human IRF5 were used as the immunogen for the IRF5 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the IRF5 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the IRF5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for IRF5

Target: IRF5 (Interferon Regulatory Factor 5 (IRF5))

Alternative Name: IRF5 (IRF5 Products)

Synonyms: IRF5 antibody, irf5 antibody, SLEB10 antibody, AW491843 antibody, mirf5 antibody, im:7155364 antibody, zgc:76986 antibody, interferon regulatory factor 5 antibody, interferon regulatory factor 5 L homeolog antibody, IRF5 antibody, irf5 antibody, Irf5 antibody, irf5.L antibody

Background: Interferon regulatory factor 5, also called IRF5 or SLEB10, is a protein that in humans is encoded by the IRF5 gene. This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity.

UniProt: Q13568

Pathways: TLR Signaling, Autophagy