KERA antibody

Catalog No. ABIN4951537

Product Details anti-KERA Antibody

Target: KERA (Keratocan (KERA))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KERA antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids YLQNNLIETIPEKPFENATQLRWINLNKNKITN of human Keratocan were used as the immunogen for the Keratocan antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Keratocan antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Keratocan antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for KERA

Target: KERA (Keratocan (KERA))

Alternative Name: Keratocan (KERA Products)

Synonyms: KERA antibody, si:dkeyp-38g8.3 antibody, zgc:136259 antibody, CNA2 antibody, SLRR2B antibody, keratocan antibody, KERA antibody, kera antibody, Kera antibody

Background: Keratocan (KTN), also known as keratan sulfate proteoglycan keratocan, is a protein that in humans is encoded by the KERA gene. It is mapped to 12q22. The protein encoded by this gene is a keratan sulfate proteoglycan that is involved in corneal transparency. Defects in this gene are a cause of autosomal recessive cornea plana 2 (CNA2). Keratan sulfate proteoglycans (KSPGs) are members of the small leucine-rich proteoglycan (SLRP) family. KSPGs, particularly keratocan, lumican and mimecan, are important to the transparency of the cornea.

UniProt: O60938

Pathways: Glycosaminoglycan Metabolic Process