HAVCR1 antibody

Catalog No. ABIN4951544

Product Details anti-HAVCR1 Antibody

Target: HAVCR1 (Hepatitis A Virus Cellular Receptor 1 (HAVCR1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HAVCR1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD of human HAVCR1 were used as the immunogen for the KIM1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the KIM1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the KIM1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for HAVCR1

Target: HAVCR1 (Hepatitis A Virus Cellular Receptor 1 (HAVCR1))

Alternative Name: KIM-1 / TIM-1 / HAVCR1 (HAVCR1 Products)

Synonyms: HAVCR antibody, HAVCR-1 antibody, KIM-1 antibody, KIM1 antibody, TIM antibody, TIM-1 antibody, TIM1 antibody, TIMD-1 antibody, TIMD1 antibody, Kim1 antibody, HAVCR1 antibody, LOC100226241 antibody, AI503787 antibody, Tim1 antibody, Timd1 antibody, hepatitis A virus cellular receptor 1 antibody, hepatitis A virus cellular receptor 1 homolog antibody, HAVCR1 antibody, Havcr1 antibody, LOC100226241 antibody

Target Type: Virus

Background: Kidney injury molecule 1, also known as HAVCR1, HAVCR or TIM1, is a protein that in humans is encoded by the HAVCR1 gene. It may play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4 (By similarity). May play a role in kidney injury and repair. [UniProt]

UniProt: Q96D42