XRCC6 antibody

Catalog No. ABIN4951571

Product Details anti-XRCC6 Antibody

Target: XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This XRCC6 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD of human Ku70 were used as the immunogen for the Ku70 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Ku70 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Ku70 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for XRCC6

Target: XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))

Alternative Name: Ku70 / XRCC6 (XRCC6 Products)

Synonyms: CTC75 antibody, CTCBF antibody, G22P1 antibody, KU70 antibody, ML8 antibody, TLAA antibody, 70kDa antibody, G22p1 antibody, Ku70 antibody, Kup70 antibody, X-ray repair cross complementing 6 antibody, ATP-dependent DNA helicase II, 70 kDa subunit antibody, X-ray repair complementing defective repair in Chinese hamster cells 6 L homeolog antibody, X-ray repair complementing defective repair in Chinese hamster cells 6 antibody, XRCC6 antibody, Bm1_41430 antibody, xrcc6.L antibody, Xrcc6 antibody

Background: XRCC6 (X-Ray Repair, Complementing Defective, In Chinese Hamster, 6), also called Ku70, G22P1 or TLAA, is a protein that in humans, is encoded by the XRCC6 gene. In addition, the XRCC6 gene encodes subunit p70 of the p70/p80 autoantigen which consists of 2 proteins of molecular mass of approximately 70,000 and 80,000 daltons that dimerize to form a 10 S DNA-binding complex. The XRCC6 gene is mapped to 22q13.2. XRCC6 and Mre11 are differentially expressed during meiosis. XRCC6 interacts with Baxa, a mediator of mitochondrial-dependent apoptosis. Disruption of both FANCC and XRCC6 suppressed sensitivity to crosslinking agents, diminished chromosome breaks, and reversed defective homologous recombination. Ku70 binds directly to free DNA ends, committing them to NHEJ repair. In early meiotic prophase, however, when meiotic recombination is most probably initiated, Mre11 was abundant, whereas XRCC6 was not detectable.

UniProt: P12956

Pathways: DNA Damage Repair