LYZ antibody

Catalog No. ABIN4951652

Product Details anti-LYZ Antibody

Target: LYZ (Lysozyme (LYZ))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LYZ antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ of human LYZ were used as the immunogen for the Lysozyme antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Lysozyme antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Lysozyme antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for LYZ

Target: LYZ (Lysozyme (LYZ))

Alternative Name: Lysozyme / LYZ (LYZ Products)

Synonyms: LZM antibody, 1 antibody, LYZC antibody, lys-C antibody, zgc:136734 antibody, BmLys antibody, LYS antibody, LZ antibody, LYZS antibody, lysozyme C antibody, LYZ antibody, lysozyme antibody, lysozyme antibody, lysozyme (renal amyloidosis) antibody, lysozyme L homeolog antibody, serum lysozyme antibody, LYZ antibody, lyz antibody, Lzm antibody, LOC781146 antibody, lyz.L antibody, S-LZ antibody

Background: In humans, the lysozyme enzyme is encoded by the LYZ gene. This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta [1-4] glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis.

UniProt: P61626