Otoferlin antibody

Catalog No. ABIN4952006

Product Details anti-Otoferlin Antibody

Target: Otoferlin (OTOF)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Otoferlin antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids QIWDADHFSADDFLGAIELDLNRFPRGAKTAKQ of human OTOF were used as the immunogen for the Otoferlin antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Otoferlin antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Otoferlin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for Otoferlin

Target: Otoferlin (OTOF)

Alternative Name: Otoferlin (OTOF Products)

Synonyms: OTOF antibody, Otof antibody, AUNB1 antibody, DFNB6 antibody, DFNB9 antibody, FER1L2 antibody, NSRD9 antibody, fj34b10 antibody, si:dkey-181f18.3 antibody, wu:fj34b10 antibody, otoferlin antibody, putative otoferlin antibody, otoferlin a antibody, OTOF antibody, LOC5565414 antibody, CpipJ_CPIJ002471 antibody, CpipJ_CPIJ010863 antibody, Smp_163750 antibody, otof antibody, Otof antibody, otofa antibody

Background: Otoferlin is a protein that in humans is encoded by the OTOF gene. Mutations in this gene are a cause of neurosensory nonsyndromic recessive deafness, DFNB9. The short form of the encoded protein has three C2 domains, a single carboxy-terminal transmembrane domain found also in the C. elegans spermatogenesis factor FER-1 and human dysferlin, while the long form has six C2 domains. The homology suggests that this protein may be involved in vesicle membrane fusion. Several transcript variants encoding multipleisoforms have been found for this gene.

UniProt: Q9HC10

Pathways: Sensory Perception of Sound, Synaptic Vesicle Exocytosis