PCSK6 antibody

Catalog No. ABIN4952032

Product Details anti-PCSK6 Antibody

Target: PCSK6 (Proprotein Convertase Subtilisin/kexin Type 6 (PCSK6))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCSK6 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids RNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLE of human PCSK6/PACE4 were used as the immunogen for the PACE4 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the PACE4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the PACE4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for PCSK6

Target: PCSK6 (Proprotein Convertase Subtilisin/kexin Type 6 (PCSK6))

Alternative Name: PCSK6 / PACE4 (PCSK6 Products)

Synonyms: PACE4 antibody, PCSK6 antibody, SPC4 antibody, C86343 antibody, Pace4 antibody, Spc4 antibody, PACE4AIIa antibody, Xpace4 antibody, spc4 antibody, proprotein convertase subtilisin/kexin type 6 antibody, peptidase S8 antibody, proprotein convertase subtilisin/kexin type 6 L homeolog antibody, PCSK6 antibody, EAMY_RS27925 antibody, pcsk6 antibody, Pcsk6 antibody, pcsk6.L antibody

Background: Proprotein convertase subtilisin/kexin type 6 is an enzyme that in humans is encoded by the PCSK6 gene. This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the trans-Golgi network where a second autocatalytic event takes place and the catalytic activity is acquired. The encoded protease is constitutively secreted into the extracellular matrix and expressed in many tissues, including neuroendocrine, liver, gut, and brain. This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. Some of its substrates include transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression and left-right patterning. Alternatively spliced transcript variants encoding different isoforms have been identified.

UniProt: P29122

Pathways: Neurotrophin Signaling Pathway, SARS-CoV-2 Protein Interactome