Parvin alpha antibody

Catalog No. ABIN4952055

Product Details anti-Parvin alpha Antibody

Target: Parvin alpha (PARVA) (Parvin, alpha (PARVA))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Parvin alpha antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids QKLQTVLEKINETLKLPPRSIKWNVDSVHAK of human Parvin alpha were used as the immunogen for the PARVA antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the PARVA antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the PARVA antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for Parvin alpha

Target: Parvin alpha (PARVA) (Parvin, alpha (PARVA))

Alternative Name: Parvin alpha / PARVA (PARVA Products)

Synonyms: CH-ILKBP antibody, MXRA2 antibody, Actp antibody, 2010012A22Rik antibody, 5430400F08Rik antibody, AI225929 antibody, AU042898 antibody, Parvin antibody, parva antibody, wu:fc59e06 antibody, zgc:101643 antibody, PARVA antibody, Parva antibody, parvin alpha antibody, parvin, alpha antibody, parvin, alpha a antibody, PARVA antibody, Parva antibody, parvaa antibody

Background: Parvin alpha is a protein that in humans is encoded by the PARVA gene. It is located on 11p15.3. PARVA belongs to the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival.

UniProt: Q9NVD7

Pathways: Smooth Muscle Cell Migration