Peroxiredoxin 4 antibody

Catalog No. ABIN4952125

Product Details anti-Peroxiredoxin 4 Antibody

Target: Peroxiredoxin 4 (PRDX4)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Peroxiredoxin 4 antibody is un-conjugated

Application: Western Blotting (WB), Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK of human Peroxiredoxin 4 were used as the immunogen for the Peroxiredoxin 4 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Peroxiredoxin 4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,ICC: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Peroxiredoxin 4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for Peroxiredoxin 4

Target: Peroxiredoxin 4 (PRDX4)

Alternative Name: Peroxiredoxin 4 / PRDX4 (PRDX4 Products)

Synonyms: MGC82793 antibody, prdx4 antibody, MGC79732 antibody, PRDX4 antibody, AOE37-2 antibody, PRX-4 antibody, AOE372 antibody, Prx-iv antibody, Prx4 antibody, TRANK antibody, fb59c09 antibody, wu:fb59c09 antibody, zgc:162938 antibody, peroxiredoxin 4 antibody, peroxiredoxin 4 L homeolog antibody, PRDX4 antibody, prdx4.L antibody, prdx4 antibody, Prdx4 antibody

Background: PRDX4 (Peroxiredoxin 4) is also known as AOE37-2. The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. Functional analysis showed that PRDX4 protects glutamine synthetase from inactivation. Yeast 2-hybrid, immunoprecipitation, and immunoblot analyses indicated that PRDX4 and PRDX1 are capable of homodimerization and heterodimerization with each other but not with the mitochondrial PRDX3. Gel mobility shift and immunoblot analysis found that PRDX4 depletes NFKB binding activity together with a reduction in the amounts of p50, p65, and phosphorylated IKBA, as well as a reduction in the expression of HIV-1 viral proteins. Expression of PRDX4, alone or with PRDX1, increased the resistance of yeast cells to oxidant-induced toxicity. Jin et al. suggested PRDX4 modulates IKBA phosphorylation in the cytoplasm and thus affects a peroxiredoxin-dependent redox step.

UniProt: Q13162