PTP4A2 antibody

Catalog No. ABIN4952318

Product Details anti-PTP4A2 Antibody

Target: PTP4A2 (Protein tyrosine Phosphatase Type IVA, Member 2 (PTP4A2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTP4A2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Purification: Antigen affinity

Immunogen: Amino acids TTLVRVCDATYDKAPVEKEGIHVLDWPFDD of human PTP4A2 were used as the immunogen for the PTP4A2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the PTP4A2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the PTP4A2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for PTP4A2

Target: PTP4A2 (Protein tyrosine Phosphatase Type IVA, Member 2 (PTP4A2))

Alternative Name: PTP4A2 (PTP4A2 Products)

Synonyms: wu:fc05f09 antibody, wu:fi84b06 antibody, zgc:101724 antibody, MGC53390 antibody, MGC80084 antibody, MGC132077 antibody, PTP4A2 antibody, ptp4a2 antibody, Prl-2 antibody, HH13 antibody, HH7-2 antibody, HU-PP-1 antibody, OV-1 antibody, PRL-2 antibody, PRL2 antibody, PTP4A antibody, PTPCAAX2 antibody, ptp-IV1a antibody, ptp-IV1b antibody, protein tyrosine phosphatase type IVA, member 2b antibody, protein tyrosine phosphatase 4a2 antibody, protein tyrosine phosphatase type IVA, member 2 antibody, protein tyrosine phosphatase type IVA, member 2 L homeolog antibody, ptp4a2b antibody, ptp4a2 antibody, PTP4A2 antibody, ptp4a2.L antibody, Ptp4a2 antibody

Background: Protein tyrosine phosphatase type IVA 2 is an enzyme that in humans is encoded by the PTP4A2 gene. The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17.

UniProt: Q12974