RAB18 antibody

Catalog No. ABIN4952337

Product Details anti-RAB18 Antibody

Target: RAB18 (RAB18, Member RAS Oncogene Family (RAB18))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB18 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREE of human RAB18 were used as the immunogen for the RAB18 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the RAB18 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the RAB18 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for RAB18

Target: RAB18 (RAB18, Member RAS Oncogene Family (RAB18))

Alternative Name: RAB18 (RAB18 Products)

Synonyms: RAB18LI1 antibody, WARBM3 antibody, AA959686 antibody, RAB18 antibody, rab18li1 antibody, LOC100219058 antibody, rab18 antibody, zgc:92523 antibody, fc62e07 antibody, wu:fc62e07 antibody, zgc:77145 antibody, RAB18, member RAS oncogene family antibody, ras-related protein Rab-18-B antibody, ras-related protein Rab-18-like antibody, Ras-related protein Rab-18 antibody, RAB18, member RAS oncogene family S homeolog antibody, RAB18B, member RAS oncogene family antibody, RAB18A, member RAS oncogene family antibody, RAB18 antibody, Rab18 antibody, rab18 antibody, LOC100219058 antibody, rab-18 antibody, rab18.S antibody, rab18b antibody, rab18a antibody

Background: Ras-related protein Rab-18 is a protein that in humans is encoded by the RAB18 gene. It is a ubiquitously expressed protein with particularly high expression in the brain. The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies in zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene.

UniProt: Q9NP72

Pathways: SARS-CoV-2 Protein Interactome