Transferrin antibody

Catalog No. ABIN4952904

Product Details anti-Transferrin Antibody

Target: Transferrin (TF)

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Transferrin antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids VPDKTVRWCAVSEHEATKCQSFRDHMKSVI of human Transferrin were used as the immunogen for the Transferrin antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Transferrin antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Transferrin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for Transferrin

Target: Transferrin (TF)

Alternative Name: Transferrin (TF Products)

Synonyms: ltf antibody, pro1557 antibody, pro2086 antibody, mgc107777 antibody, LOC692564 antibody, TF antibody, LOC100144362 antibody, tf antibody, LTF antibody, TFEW antibody, conalbumin antibody, tf-b antibody, MGC64306 antibody, PRO1557 antibody, PRO2086 antibody, TFQTL1 antibody, AI266983 antibody, Cd176 antibody, HP antibody, Tf antibody, Tfn antibody, hpx antibody, Trf antibody, cb285 antibody, gavi antibody, id:ibd3238 antibody, id:ibd3525 antibody, sb:cb285 antibody, wu:fb57g06 antibody, wu:fb62h02 antibody, wu:fb63h10 antibody, wu:fb64h10 antibody, zgc:112154 antibody, 143958_at antibody, CG6186 antibody, Dmel\\CG6186 antibody, TSF1 antibody, anon-EST:Posey265 antibody, tsf1 antibody, Pro-TRH antibody, IL-5 antibody, STF I antibody, TRF1 antibody, sTF1 antibody, sTf antibody, tf1 antibody, transferrin antibody, serotransferrin antibody, transferrin (ovotransferrin) antibody, transferrin L homeolog antibody, melanotransferrin antibody, transferrin-a antibody, Transferrin 1 antibody, thyrotropin releasing hormone antibody, interleukin 5 antibody, TF antibody, LOC477072 antibody, tf antibody, Tf antibody, LOC100144362 antibody, tf.L antibody, LOC5575625 antibody, Trf antibody, tfa antibody, Tsf1 antibody, TRH antibody, IL5 antibody, LOC101085148 antibody, LOC100726872 antibody, trf antibody

Background: Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. In humans, it is encoded by the TF gene. Transferrin consists of a polypeptide chain containing 679 amino acids in humans. The protein is composed of alpha helices and beta sheets to form two domains. The N- and C- terminal sequences are represented by globular lobes and between the two lobes is an iron-binding site. Transferrin is a glycoprotein that binds iron very tightly but reversibly.

UniProt: P02787

Pathways: Transition Metal Ion Homeostasis