Transferrin antibody
-
- Target See all Transferrin (TF) Antibodies
- Transferrin (TF)
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Transferrin antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity
- Immunogen
- Amino acids VPDKTVRWCAVSEHEATKCQSFRDHMKSVI of human Transferrin were used as the immunogen for the Transferrin antibody.
- Isotype
- IgG
- Top Product
- Discover our top product TF Primary Antibody
-
-
- Application Notes
- Optimal dilution of the Transferrin antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the Transferrin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- Transferrin (TF)
- Alternative Name
- Transferrin (TF Products)
- Synonyms
- ltf antibody, pro1557 antibody, pro2086 antibody, mgc107777 antibody, LOC692564 antibody, TF antibody, LOC100144362 antibody, tf antibody, LTF antibody, TFEW antibody, conalbumin antibody, tf-b antibody, MGC64306 antibody, PRO1557 antibody, PRO2086 antibody, TFQTL1 antibody, AI266983 antibody, Cd176 antibody, HP antibody, Tf antibody, Tfn antibody, hpx antibody, Trf antibody, cb285 antibody, gavi antibody, id:ibd3238 antibody, id:ibd3525 antibody, sb:cb285 antibody, wu:fb57g06 antibody, wu:fb62h02 antibody, wu:fb63h10 antibody, wu:fb64h10 antibody, zgc:112154 antibody, 143958_at antibody, CG6186 antibody, Dmel\\CG6186 antibody, TSF1 antibody, anon-EST:Posey265 antibody, tsf1 antibody, Pro-TRH antibody, IL-5 antibody, STF I antibody, TRF1 antibody, sTF1 antibody, sTf antibody, tf1 antibody, transferrin antibody, serotransferrin antibody, transferrin (ovotransferrin) antibody, transferrin L homeolog antibody, melanotransferrin antibody, transferrin-a antibody, Transferrin 1 antibody, thyrotropin releasing hormone antibody, interleukin 5 antibody, TF antibody, LOC477072 antibody, tf antibody, Tf antibody, LOC100144362 antibody, tf.L antibody, LOC5575625 antibody, Trf antibody, tfa antibody, Tsf1 antibody, TRH antibody, IL5 antibody, LOC101085148 antibody, LOC100726872 antibody, trf antibody
- Background
- Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. In humans, it is encoded by the TF gene. Transferrin consists of a polypeptide chain containing 679 amino acids in humans. The protein is composed of alpha helices and beta sheets to form two domains. The N- and C- terminal sequences are represented by globular lobes and between the two lobes is an iron-binding site. Transferrin is a glycoprotein that binds iron very tightly but reversibly.
- UniProt
- P02787
- Pathways
- Transition Metal Ion Homeostasis
-