Golgi SNAP Receptor Complex Member 1 (GOSR1) (C-Term) antibody

Details for Product No. ABIN4960978, Supplier: Log in to see
  • CG7700
  • Dmel\\CG7700
  • FSG28
  • GOS28
  • dgos28
  • GOSR1
  • gosr1
  • zgc:112064
  • GOLIM2
  • GOS-28
  • GOS28/P28
  • GS28
  • P28
  • AI414660
  • AI426320
  • BB145494
  • p28
  • Gos28
  • v-SNARE
  • Golgi SNARE, 28 kDa
  • golgi SNAP receptor complex member 1
  • Golgi SNAP receptor complex member 1
  • Gos28
  • GOSR1
  • gosr1
  • CpipJ_CPIJ014329
  • PAAG_02888
  • Tsp_07481
  • Gosr1
  • gos-28
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to GOSR1 (golgi SNAP receptor complex member 1) The peptide sequence was selected form the C terminal of GOSR1. Peptide sequence IHSKMNTLANRFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH.
Purification Immunogen affinity purified
Alternative Name GOSR1 (GOSR1 Antibody Abstract)
Background Gene Symbol: GOSR1
Gene ID 9527
UniProt O95249
Application Notes Western BlotThis is a rabbit polyclonal antibody against GOSR1 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Golgi SNAP Receptor Complex Member 1 (GOSR1) (C-Term) antibody (ABIN4960978) Western Blot: GOSR1 Antibody - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.
Did you look for something else?