BMP6 antibody (Bone Morphogenetic Protein 6)

Details for Product anti-BMP6 Antibody No. ABIN5075308, Supplier: Log in to see
  • BMP6
  • zgc:113595
  • vgr
  • vgr-1
  • vgr1
  • VGR
  • VGR1
  • D13Wsu115e
  • Vgr1
  • bone morphogenetic protein 6
  • bone morphogenetic protein 6 S homeolog
  • BMP6
  • bmp6
  • bmp6.S
  • Bmp6
anti-Human BMP6 antibody for Immunohistochemistry (Paraffin-embedded Sections)
This BMP6 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF)
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELY
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Alternative Name BMP-6 (BMP6 Antibody Abstract)
Background Gene Symbol: BMP6
Gene ID 654
Pathways Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-Bone Morphogenetic Protein 6 (BMP6) antibody (ABIN5075308) Immunocytochemistry/Immunofluorescence: BMP-6 Antibody - Staining of human cell line...
Did you look for something else?