PFKP antibody (phosphofructokinase, Platelet)

Details for Product anti-PFKP Antibody No. ABIN5078771
Antigen
  • pfk
  • pfk-c
  • pfkf
  • PFKP
  • PFK-C
  • PFKF
  • 1200015H23Rik
  • 9330125N24Rik
  • PFKM
  • phosphofructokinase, platelet
  • phosphofructokinase, platelet S homeolog
  • ATP-dependent 6-phosphofructokinase, platelet type
  • pfkp
  • PFKP
  • pfkp.S
  • LOC100549777
  • Pfkp
Reactivity
Human
115
30
27
12
1
Host
Rabbit
84
35
Clonality
Polyclonal
Conjugate
This PFKP antibody is un-conjugated
4
3
3
3
3
3
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
101
76
40
28
27
21
10
7
6
2
1
1
Options
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MECVQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINV
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Plasmids, Primers & others Plasmids, Primers & others PFKP products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name PFKP (PFKP Antibody Abstract)
Background Gene Symbol: PFKP
Gene ID 5214
Application Notes Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Image no. 1 for anti-phosphofructokinase, Platelet (PFKP) antibody (ABIN5078771) Western Blot: PFKP Antibody - Western blot analysis in human cell line RT-4 and huma...
Image no. 2 for anti-phosphofructokinase, Platelet (PFKP) antibody (ABIN5078771) Immunocytochemistry/Immunofluorescence: PFKP Antibody - Staining of human cell line ...
Did you look for something else?