RASA1 antibody (RAS P21 Protein Activator (GTPase Activating Protein) 1)

Details for Product anti-RASA1 Antibody No. ABIN5079231
Antigen
  • CG9209
  • D-RasGAP
  • Dmel\\CG9209
  • RAS-GAP
  • RasGAP
  • RasGap
  • rasGap
  • CM-AVM
  • CMAVM
  • GAP
  • PKWS
  • RASA
  • RASGAP
  • p120GAP
  • p120RASGAP
  • GAPX
  • Rasa
  • Gap
  • vacuolar peduncle
  • RAS p21 protein activator 1
  • vap
  • RASA1
  • Rasa1
Reactivity
Human
113
59
57
5
2
2
2
2
2
2
1
1
1
Host
Rabbit
92
20
2
1
Clonality
Polyclonal
Conjugate
This RASA1 antibody is un-conjugated
6
5
5
3
3
3
3
3
3
2
2
2
2
2
2
2
2
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
78
36
26
16
15
9
8
2
2
1
1
1
Options
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQ
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Plasmids, Primers & others Plasmids, Primers & others RASA1 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name Ras-GAP (RASA1 Antibody Abstract)
Background Gene Symbol: RASA1
Gene ID 5921
Pathways Regulation of Actin Filament Polymerization, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals
Application Notes Immunohistochemistry-Paraffin 1:1000 - 1:2500This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Image no. 1 for anti-RAS P21 Protein Activator (GTPase Activating Protein) 1 (RASA1) antibody (ABIN5079231) Immunohistochemistry-Paraffin: Ras-GAP Antibody - Staining in human placenta and pan...
Image no. 2 for anti-RAS P21 Protein Activator (GTPase Activating Protein) 1 (RASA1) antibody (ABIN5079231) Immunohistochemistry-Paraffin: Ras-GAP Antibody - Staining of human pancreas shows l...
Did you look for something else?