RPP40 antibody (Ribonuclease P/MRP 40kDa Subunit) (AA 1-244) Primary Antibody
RPP40
Reactivity: Human
IF, WB
Host: Mouse
Polyclonal
camera_alt 3
Catalog No. ABIN524220
$440.00
Plus shipping costs $45.00
50 μL
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Binding Specificity
- AA 1-244
- Reactivity
- Human
- Host
- Mouse
- Clonality
- Polyclonal
- Application
- Immunofluorescence (IF), Western Blotting (WB)
- Purpose
- Mouse polyclonal antibody raised against a full-length human RPP40 protein.
- Brand
- MaxPab®
- Cross-Reactivity
- Human
- Immunogen
immunogen: RPP40 (AAH17871.1, 1 a.a. ~ 244 a.a) full-length human protein.
Immunogen Sequence: MNTGPYYFVKNLPLHELITPEFISTFIKKGKLILSLDKDTYEETGLQGHPSQFSGRKIMKFIVSIDLMELSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVALSTLRDLQCPVLQSSELEGTPEVSCRALELFDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKK
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody reactive against mammalian transfected lysate.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- No additive
- Preservative
- Without preservative
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- Alternative Name
- RPP40 (RPP40 Antibody Abstract)
- Synonyms
- D8Bwg1265e, Rnasep1, RNASEP1, bA428J1.3, ribonuclease P 40 subunit, ribonuclease P/MRP subunit p40, Rpp40, RPP40
- Background
- Full Gene Name: ribonuclease P/MRP 40 kDa subunit
Synonyms: RNASEP1,bA428J1.3 - Gene ID
- 10799
You are here: