Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

PDS5A antibody (PDS5, Regulator of Cohesion Maintenance, Homolog A) (AA 1-333) Primary Antibody

PDS5A Reactivity: Human IF, WB Host: Mouse Polyclonal unconjugated
Catalog No. ABIN525049
$600.00
Plus shipping costs $45.00
50 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    PDS5A
    Binding Specificity
    • 15
    • 12
    • 10
    • 8
    • 4
    • 1
    • 1
    • 1
    AA 1-333
    Reactivity
    • 46
    • 6
    • 5
    • 3
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    Human
    Host
    • 45
    • 1
    Mouse
    Clonality
    • 46
    Polyclonal
    Conjugate
    • 17
    • 4
    • 4
    • 4
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This PDS5A antibody is un-conjugated
    Application
    • 26
    • 24
    • 13
    • 13
    • 3
    • 3
    • 3
    • 3
    • 1
    • 1
    • 1
    Immunofluorescence (IF), Western Blotting (WB)
    Purpose
    Mouse polyclonal antibody raised against a full-length human SCC-112 protein.
    Brand
    MaxPab®
    Cross-Reactivity
    Human
    Immunogen

    immunogen: SCC-112 (AAH09650.1, 1 a.a. ~ 333 a.a) full-length human protein.

    Immunogen Sequence: MIHLLAHDPDFTRSQDVDQLRDIKECLWFMLEVLMTKNENNSHAFMKKMAENIKLTRDAQSPDESKTNEKLYTVCDVALCVINSKSALCNADSPKDPVLPMKFFTQPEKDFCNDKSYISEETRVLLLTGKPKPAGVLGAVNKPLSATGRKPYVRSTGTETGSNINVNSELNPSTGNRSREQSSEAAETGVSENEENPVRIISVTPVKNIDPVKNKEINSDQATQGNISSDRGKKRTVTAAGAENIQQKTDEKVDESGPPAPSKPRRGRRPKSESQGNATKNDDLNKPINKGRKRAAVGQESPGGLEAGNAKAPKLQDLAKKAAPAERQIDLQR

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody reactive against mammalian transfected lysate.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    No additive
    Preservative
    Without preservative
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    PDS5A
    Alternative Name
    PDS5A (PDS5A Antibody Abstract)
    Synonyms
    PDS5A, pds5a-A, pds5a-B, SCC-112, SCC112, 9030416H16Rik, E230024D05Rik, mKIAA0648, RGD1307094, Scc-112, Aprin, zgc:153878, zgc:66331, PDS5 cohesin associated factor A, PDS5 cohesin associated factor A S homeolog, PDS5A, pds5a.S, Pds5a, pds5a
    Background
    Full Gene Name: PDS5, regulator of cohesion maintenance, homolog A (S. cerevisiae)
    Synonyms: DKFZp686B19246,FLJ41012,KIAA0648,MGC131948,MGC161503,PIG54,SCC-112
    Gene ID
    23244
You are here:
help Support