IFFO1 antibody (Intermediate Filament Family Orphan 1) (AA 1-200)

Details for Product anti-IFFO1 Antibody No. ABIN525494
Antigen
  • RGD1308257
  • IFFO
  • MGC151662
  • iffo
  • si:ch211-288g17.1
  • HOM-TES-103
  • 4733401N06Rik
  • A930037G23Rik
  • Iffo
  • intermediate filament family orphan 1
  • intermediate filament family orphan 1a
  • Iffo1
  • IFFO1
  • iffo1a
Epitope
AA 1-200
3
2
2
1
Reactivity
Human
16
8
8
3
3
2
2
2
2
1
Host
Mouse
16
Clonality
Polyclonal
Conjugate
This IFFO1 antibody is un-conjugated
1
1
Application
Western Blotting (WB)
16
7
6
3
3
1
1
Options
Purpose Mouse polyclonal antibody raised against a full-length human HOM-TES-103 protein.
Brand MaxPab®
Immunogen

immunogen: HOM-TES-103 (NP_542769.2, 1 a.a. ~ 200 a.a) full-length human protein.

Immunogen Sequence: MGGRKRERKAAVEEDTSLSESEGPRQPDGDEEESTALSINEEMQRMLNQLREYDFEDDCDSLTWEETEETLLLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTREKEYQETIDQIELELATAKNDMNRHLHEYMEMCSMKRGLDVQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR

Cross-Reactivity Human
Plasmids, Primers & others Plasmids, Primers & others IFFO1 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name IFFO1 (IFFO1 Antibody Abstract)
Background Full Gene Name: intermediate filament family orphan 1
Synonyms: DKFZp586I2223,FLJ20703,HOM-TES-103,IFFO,MGC117359
Gene ID 25900
NCBI Accession NP_542769, NM_080731
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions For Research Use only
Format Liquid
Buffer No additive
Preservative Without preservative
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Intermediate Filament Family Orphan 1 (IFFO1) (AA 1-200) antibody (ABIN525494) Western Blot analysis of IFFO1 expression in transfected 293T cell line by IFFO1 MaxP...
Did you look for something else?