INTU antibody (Inturned Planar Cell Polarity Effector Homolog (Drosophila)) (AA 1-408) Primary Antibody
INTU
Reactivity: Human
WB
Host: Mouse
Polyclonal
camera_alt 2
Catalog No. ABIN525865
$440.00
Plus shipping costs $45.00
50 μL
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Binding Specificity
- AA 1-408
- Reactivity
- Human
- Host
- Mouse
- Clonality
- Polyclonal
- Conjugate
- This INTU antibody is un-conjugated
- Application
- Western Blotting (WB)
- Purpose
- Mouse polyclonal antibody raised against a full-length human PDZD6 protein.
- Brand
- MaxPab®
- Cross-Reactivity
- Human
- Immunogen
immunogen: PDZD6 (ENSP00000296461, 1 a.a. ~ 408 a.a) full-length human protein.
Immunogen Sequence: MASVASCDSRPSSDELPGDPSSQEEDEDYDFEDRVSDSGSYSSASSDYDDLEPEWLDSVQKNGELFYLELSEDEEESLLPETPTVNHVRFSENEIIIEDDYKERKKYEPKLKQFTKILRRKRLLPKRCNKKNSNDNGPVSILKHQSNQKTGVIVQQRYKDVNVYVNPKKLTVIKAKEQLKLLEVLVGIIHQTKWSWRRTGKQGDGERLVVHGLLPGGSAMKSGQVLIGDVLVAVNDVDVTTENIERVLSCIPGPMQVKLTFENAYDVKRETSHPRQKKTQSNTSDLVKLLWGEEVEGIQQSGLNTPHIIMYLTLQLDSETSKEEQEILYHYPMSEASQKLKSVRGIFLTLCDMLENVTGTQVTSSSLLLNGKQIHVAYWKESDKLLLIGLPAEEIELPSSAHTHGERN
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody reactive against mammalian transfected lysate.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- No additive
- Preservative
- Without preservative
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- Alternative Name
- INTU (INTU Antibody Abstract)
- Synonyms
- 9230116I04Rik, 9430087H23Rik, Pdzd6, Pdzk6, mKIAA1284, INT, PDZD6, PDZK6, Xint, in, int, pdzd6, inturned planar cell polarity protein, inturned planar cell polarity protein S homeolog, Intu, INTU, intu, intu.S
- Background
- Full Gene Name: inturned planar cell polarity effector homolog (Drosophila)
Synonyms: FLJ41326,INT,KIAA1284,PDZD6,PDZK6 - Gene ID
- 27152
You are here: