Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

RDH8 antibody (Retinol Dehydrogenase 8 (All-Trans)) (AA 1-311) Primary Antibody

RDH8 Reactivity: Human WB Host: Mouse Polyclonal
Catalog No. ABIN526329
$440.00
Plus shipping costs $45.00
50 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Binding Specificity
    AA 1-311
    Reactivity
    Human
    Host
    Mouse
    Clonality
    Polyclonal
    Application
    Western Blotting (WB)
    Purpose
    Mouse polyclonal antibody raised against a full-length human RDH8 protein.
    Brand
    MaxPab®
    Cross-Reactivity
    Human
    Immunogen

    immunogen: RDH8 (AAI46480.1, 1 a.a. ~ 311 a.a) full-length human protein.

    Immunogen Sequence: MAAAPRTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLGKKETLEAAAGEALGQTLTVAQLDVCSDESVAQCLSCIQGEVDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASKFALEGFFESLAIQLLQFNIFISLVEPGPVVTEFEGKLLAQVSMAEFPGTDPETLHYFRDLYLPASRKLFCSVGQNPQDVVQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCLSCGCLPTRVRPR

  • Target
    Alternative Name
    RDH8 (RDH8 Antibody Abstract)
    Background
    Full Gene Name: retinol dehydrogenase 8 (all-trans)
    Synonyms: PRRDH,SDR28C2
    Gene ID
    50700
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody reactive against mammalian transfected lysate.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    No additive
    Preservative
    Without preservative
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
You are here:
help Support