serine/threonine/tyrosine Interacting-Like 1 (STYXL1) (AA 1-313) antibody

Details for Product No. ABIN526848
Antigen
  • DUSP24
  • MK-STYX
  • serine/threonine/tyrosine interacting like 1
  • STYXL1
Epitope
AA 1-313
5
2
1
Reactivity
Human
10
2
2
2
1
1
1
1
1
1
Host
Mouse
6
4
Clonality
Polyclonal
Application
Western Blotting (WB)
10
1
1
Options
Purpose Mouse polyclonal antibody raised against a full-length human STYXL1 protein.
Brand MaxPab®
Immunogen

immunogen: STYXL1 (NP_057170, 1 a.a. ~ 313 a.a) full-length human protein.

Immunogen Sequence: MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTILGDSITNIMDPLY

Cross-Reactivity Human
Antigen
Alternative Name STYXL1 (STYXL1 Antibody Abstract)
Background Full Gene Name: serine/threonine/tyrosine interacting-like 1
Synonyms: DUSP24,MK-STYX
Gene ID 51657
NCBI Accession NP_057170, NM_016086
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions For Research Use only
Format Liquid
Buffer No additive
Preservative Without preservative
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-serine/threonine/tyrosine Interacting-Like 1 (STYXL1) (AA 1-313) antibody (ABIN526848) Western Blot analysis of STYXL1 expression in transfected 293T cell line by STYXL1 Ma...
Image no. 2 for anti-serine/threonine/tyrosine Interacting-Like 1 (STYXL1) (AA 1-313) antibody (ABIN526848) STYXL1 MaxPab polyclonal antibody. Western Blot analysis of STYXL1 expression in huma...
Did you look for something else?