Deleted In Azoospermia 4 (DAZ4) (AA 1-390) antibody

Details for Product No. ABIN528115
Antigen
Epitope
AA 1-390
10
8
8
7
3
3
1
Reactivity
Human
52
19
19
4
3
3
2
2
2
2
Host
Mouse
52
Clonality
Polyclonal
Conjugate
Un-conjugated
4
3
3
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Application
Western Blotting (WB)
33
24
19
13
8
1
1
Options
Purpose Mouse polyclonal antibody raised against a full-length human DAZ4 protein.
Brand MaxPab®
Immunogen

immunogen: DAZ4 (NP_065153, 1 a.a. ~ 390 a.a) full-length human protein.

Immunogen Sequence: MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQPFPAYPSSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQRRD

Cross-Reactivity Human
Antigen
Alternative Name DAZ4 (DAZ4 Antibody Abstract)
Background Full Gene Name: deleted in azoospermia 4
Synonyms: DAZ,DAZ1,pDP1680,pDP1681
Gene ID 57135
NCBI Accession NP_065153, NM_020420
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions For Research Use only
Format Liquid
Buffer No additive
Preservative Without preservative
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Deleted In Azoospermia 4 (DAZ4) (AA 1-390) antibody (ABIN528115) Western Blot analysis of DAZ4 expression in transfected 293T cell line by DAZ4 MaxPab...