MASA antibody (Enolase-Phosphatase 1) (AA 1-261)

Details for Product anti-ENOPH1 Antibody No. ABIN528343
Antigen
Epitope
AA 1-261
3
2
2
2
2
1
1
Reactivity
Human
20
9
8
3
3
3
3
3
3
2
2
1
1
Host
Mouse
17
3
Clonality
Polyclonal
Application
Western Blotting (WB)
20
8
1
Options
Purpose Mouse polyclonal antibody raised against a full-length human MASA protein.
Brand MaxPab®
Immunogen

immunogen: MASA (NP_067027, 1 a.a. ~ 261 a.a) full-length human protein.

Immunogen Sequence: MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST

Cross-Reactivity Human
Antigen
Alternative Name ENOPH1 (ENOPH1 Antibody Abstract)
Background Full Gene Name: enolase-phosphatase 1
Synonyms: DKFZp586M0524,E1,FLJ12594,MASA,MST145
Gene ID 58478
NCBI Accession NP_067027, NM_021204
Pathways Methionine Biosynthetic Process
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions For Research Use only
Format Liquid
Buffer No additive
Preservative Without preservative
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Enolase-Phosphatase 1 (ENOPH1) (AA 1-261) antibody (ABIN528343) Western Blot analysis of ENOPH1 expression in transfected 293T cell line by ENOPH1 Ma...
Image no. 2 for anti-Enolase-Phosphatase 1 (ENOPH1) (AA 1-261) antibody (ABIN528343) MASA MaxPab polyclonal antibody. Western Blot analysis of MASA expression in human sp...