Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

MUTED antibody (Muted Homolog) (AA 1-187) Primary Antibody

MUTED Reactivity: Human WB Host: Mouse Polyclonal unconjugated
Catalog No. ABIN528480
$600.00
Plus shipping costs $45.00
50 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    MUTED
    Binding Specificity
    • 9
    • 8
    • 7
    • 7
    • 4
    • 3
    • 1
    • 1
    AA 1-187
    Reactivity
    • 25
    • 13
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    Human
    Host
    • 24
    • 1
    Mouse
    Clonality
    • 25
    Polyclonal
    Conjugate
    • 10
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    This MUTED antibody is un-conjugated
    Application
    • 20
    • 18
    • 15
    • 1
    Western Blotting (WB)
    Purpose
    Mouse polyclonal antibody raised against a full-length human MUTED protein.
    Brand
    MaxPab®
    Cross-Reactivity
    Human
    Immunogen

    immunogen: MUTED (NP_958437, 1 a.a. ~ 187 a.a) full-length human protein.

    Immunogen Sequence: MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGLREMRVLENLKNMIHETNEHTLPKCRDTMRDSLSQVLQRLQAANDSVCRLQQREQERKKIHSDHLVASEKQHMLQWDNFMKEQPNKRAEVDEEHRKAMERLKEQYAEMEKDLAKFSTF

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody reactive against mammalian transfected lysate.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    No additive
    Preservative
    Without preservative
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    MUTED
    Alternative Name
    MUTED (MUTED Antibody Abstract)
    Synonyms
    BLOS5, MU, MUTED, muted, 1810074A19Rik, Muted, mu, biogenesis of lysosomal organelles complex 1 subunit 5, biogenesis of lysosomal organelles complex 1 subunit 5 L homeolog, biogenesis of lysosomal organelles complex-1, subunit 5, muted, BLOC1S5, bloc1s5.L, Bloc1s5
    Background
    Full Gene Name: muted homolog (mouse)
    Synonyms: DKFZp686E2287,MU
    Gene ID
    63915
    NCBI Accession
    NP_958437, NM_201280
You are here:
help Support