ZNF614 antibody (Zinc Finger Protein 614) (AA 1-198)

Details for Product anti-ZNF614 Antibody No. ABIN529182
Antigen
  • ZNF614
  • zinc finger protein 614
  • ZNF614
Epitope
AA 1-198
9
8
7
7
4
2
2
1
1
Reactivity
Human
29
3
1
1
1
Host
Mouse
29
Clonality
Polyclonal
Conjugate
This ZNF614 antibody is un-conjugated
3
3
3
2
2
2
Application
Immunofluorescence (IF), Western Blotting (WB)
26
19
1
Options
Purpose Mouse polyclonal antibody raised against a full-length human ZNF614 protein.
Brand MaxPab®
Immunogen

immunogen: ZNF614 (ENSP00000348674, 1 a.a. ~ 198 a.a) full-length human protein.

Immunogen Sequence: MIKTQESLTLEDVAVEFSWEEWQLLDTAQKNLYRDVMVENYNHLVSLGYQTSKPDVLSKLAHGQEPWTTDAKIQNKNCPGIGKVDSHLQEHSPNQRLLKSVQQCNGQNTLRNIVHLSKTHFPIVQNHDTFDLYRKNLKSSLSLINQKRRHGINNPVEFIGETGSLERPRQADHLRSEVQDQPGQRGETLCLLKIHTKN

Cross-Reactivity Human
Plasmids, Primers & others Plasmids, Primers & others ZNF614 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name ZNF614 (ZNF614 Antibody Abstract)
Background Full Gene Name: zinc finger protein 614
Synonyms: FLJ21941,MGC120638
Gene ID 80110
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions For Research Use only
Format Liquid
Buffer No additive
Preservative Without preservative
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Zinc Finger Protein 614 (ZNF614) (AA 1-198) antibody (ABIN529182) Western Blot analysis of ZNF614 expression in transfected 293T cell line by ZNF614 Ma...
Image no. 2 for anti-Zinc Finger Protein 614 (ZNF614) (AA 1-198) antibody (ABIN529182) Immunofluorescence of purified MaxPab antibody to ZNF614 on HeLa cell. [antibody conc...
Did you look for something else?