Retinol Binding Protein 5, Cellular (RBP5) (AA 1-135) antibody

Details for Product No. ABIN529497
Target
Binding Specificity
AA 1-135
13
7
6
5
2
1
Reactivity
Human
33
10
9
6
1
Host
Mouse
42
9
6
Clonality
Polyclonal
Conjugate
Un-conjugated
12
8
1
1
1
1
1
1
1
Application
Western Blotting (WB)
37
30
27
12
10
10
7
3
3
2
1
1
Options
Purpose Mouse polyclonal antibody raised against a full-length human RBP5 protein.
Brand MaxPab®
Immunogen

immunogen: RBP5 (NP_113679.1, 1 a.a. ~ 135 a.a) full-length human protein.

Immunogen Sequence: MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR

Cross-Reactivity Human
Target
Alternative Name RBP5 (RBP5 Antibody Abstract)
Background Full Gene Name: retinol binding protein 5, cellular
Synonyms: CRBP-III,CRBP3,CRBPIII
Gene ID 83758
NCBI Accession NP_113679, NM_031491
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions For Research Use only
Format Liquid
Buffer No additive
Preservative Without preservative
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Retinol Binding Protein 5, Cellular (RBP5) (AA 1-135) antibody (ABIN529497) Western Blot analysis of RBP5 expression in transfected 293T cell line by RBP5 MaxPab...