TRMT61A antibody (tRNA Methyltransferase 61 Homolog A (S. Cerevisiae)) (AA 1-289) Primary Antibody
TRMT61A
Reactivity: Human
WB
Host: Mouse
Polyclonal
camera_alt 1
Catalog No. ABIN530348
$440.00
Plus shipping costs $45.00
50 μL
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Binding Specificity
- AA 1-289
- Reactivity
- Human
- Host
- Mouse
- Clonality
- Polyclonal
- Application
- Western Blotting (WB)
- Purpose
- Mouse polyclonal antibody raised against a full-length human C14orf172 protein.
- Brand
- MaxPab®
- Cross-Reactivity
- Human
- Immunogen
immunogen: C14orf172 (NP_689520, 1 a.a. ~ 289 a.a) full-length human protein.
Immunogen Sequence: MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGTDGPAGSDTSPFRSGTPMKEAVGHTGYLTFATKTPG
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody reactive against mammalian transfected lysate.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- No additive
- Preservative
- Without preservative
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- Alternative Name
- TRMT61A (TRMT61A Antibody Abstract)
- Background
- Full Gene Name: tRNA methyltransferase 61 homolog A (S. cerevisiae)
Synonyms: C14orf172,FLJ40452,GCD14,Gcd14p,TRM61,hTRM61 - Gene ID
- 115708
- NCBI Accession
- NP_689520, NM_152307
You are here: