Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Lysozyme-Like 2 (LYZL2) (AA 1-194) antibody Primary Antibody

LYZL2 Reactivity: Human WB Host: Mouse Polyclonal
Catalog No. ABIN530460
$440.00
Plus shipping costs $45.00
50 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Binding Specificity
    AA 1-194
    Reactivity
    Human
    Host
    Mouse
    Clonality
    Polyclonal
    Conjugate
    Un-conjugated
    Application
    Western Blotting (WB)
    Purpose
    Mouse polyclonal antibody raised against a full-length human LYZL2 protein.
    Brand
    MaxPab®
    Cross-Reactivity
    Human
    Immunogen

    immunogen: LYZL2 (NP_898881, 1 a.a. ~ 194 a.a) full-length human protein.

    Immunogen Sequence: MQDAPLSCLSPTKWSSVSSADSTEKSASAAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALVTDDLTDAIICAKKIVKETQGMNYWQGWKKHCEGRDLSDWKKDCEVS

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody reactive against mammalian transfected lysate.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    No additive
    Preservative
    Without preservative
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    Alternative Name
    LYZL2 (LYZL2 Antibody Abstract)
    Synonyms
    lysozyme like 2, LYZL2
    Background
    Full Gene Name: lysozyme-like 2
    Synonyms:
    Gene ID
    119180
    NCBI Accession
    NP_898881, NM_183058
You are here: