ADAM Metallopeptidase with thrombospondin Type 1 Motif, 17 (ADAMTS17) (AA 543-650) antibody

Details for Product No. ABIN531218
Antigen
  • AU023434
  • ADAMTS17
  • a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 17
  • ADAM metallopeptidase with thrombospondin type 1 motif 17
  • ADAM metallopeptidase with thrombospondin type 1 motif, 17
  • Adamts17
  • ADAMTS17
  • adamts17
Epitope
AA 543-650
6
3
1
1
1
1
Reactivity
Human
25
20
3
Host
Mouse
17
8
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
1
Application
ELISA, Western Blotting (WB)
17
16
12
6
1
1
Options
Purpose Mouse polyclonal antibody raised against a partial recombinant ADAMTS17.
Immunogen

immunogen: ADAMTS17 (NP_620688, 543 a.a. ~ 650 a.a) partial recombinant protein with GST tag.

Immunogen Sequence: DGDWSPWGAWSMCSRTCGTGARFRQRKCDNPPPGPGGTHCPGASVEHAVCENLPCPKGLPSFRDQQCQAHDRLSPKKKGLLTAVVVDDKPCELYCSPLGKESPLLVAD

Cross-Reactivity Human
Antigen
Alternative Name ADAMTS17 (ADAMTS17 Antibody Abstract)
Background Full Gene Name: ADAM metallopeptidase with thrombospondin type 1 motif, 17
Synonyms: FLJ16363,FLJ32769
Gene ID 170691
NCBI Accession NP_620688, NM_139057
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer 50 % glycerol
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-ADAM Metallopeptidase with thrombospondin Type 1 Motif, 17 (ADAMTS17) (AA 543-650) antibody (ABIN531218) Western Blot detection against Immunogen (37.99 KDa) .
Did you look for something else?