Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

NEIL2 antibody (Nei Endonuclease VIII-Like 2 (E. Coli)) (AA 1-332) Primary Antibody

NEIL2 Reactivity: Human WB Host: Mouse Polyclonal unconjugated
Catalog No. ABIN531425
$600.00
Plus shipping costs $45.00
50 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    NEIL2
    Binding Specificity
    AA 1-332
    • 11
    • 9
    • 8
    • 3
    • 1
    • 1
    • 1
    • 1
    Reactivity
    Human
    • 36
    • 11
    • 5
    • 4
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    Host
    Mouse
    • 32
    • 4
    Clonality
    Polyclonal
    • 32
    • 4
    Conjugate
    This NEIL2 antibody is un-conjugated
    • 17
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Western Blotting (WB)
    • 31
    • 19
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Purpose
    Mouse polyclonal antibody raised against a full-length human NEIL2 protein.
    Brand
    MaxPab®
    Cross-Reactivity
    Human
    Immunogen

    immunogen: NEIL2 (NP_659480.1, 1 a.a. ~ 332 a.a) full-length human protein.

    Immunogen Sequence: MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody reactive against mammalian transfected lysate.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    No additive
    Preservative
    Without preservative
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    NEIL2
    Alternative Name
    NEIL2 (NEIL2 Antibody Abstract)
    Synonyms
    NEH2, NEI2, Gm1212, nei like DNA glycosylase 2, nei like 2 (E. coli), NEIL2, Neil2
    Background
    Full Gene Name: nei like 2 (E. coli)
    Synonyms: FLJ31644,MGC2832,MGC4505,NEH2,NEI2
    Gene ID
    252969
    NCBI Accession
    NP_659480, NM_145043
    Pathways
    DNA Damage Repair
You are here:
help Support