NEIL2 antibody (Nei Endonuclease VIII-Like 2 (E. Coli)) (AA 1-332)

Details for Product anti-NEIL2 Antibody No. ABIN531425
Antigen
Epitope
AA 1-332
11
10
8
5
2
1
1
1
Reactivity
Human
45
13
9
5
4
2
2
2
1
1
Host
Mouse
38
7
Clonality
Polyclonal
Conjugate
This NEIL2 antibody is un-conjugated
3
2
2
2
2
2
1
1
1
1
1
1
Application
Western Blotting (WB)
40
19
3
2
2
1
1
1
Options
Purpose Mouse polyclonal antibody raised against a full-length human NEIL2 protein.
Brand MaxPab®
Immunogen

immunogen: NEIL2 (NP_659480.1, 1 a.a. ~ 332 a.a) full-length human protein.

Immunogen Sequence: MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS

Cross-Reactivity Human
Antigen
Alternative Name NEIL2 (NEIL2 Antibody Abstract)
Background Full Gene Name: nei like 2 (E. coli)
Synonyms: FLJ31644,MGC2832,MGC4505,NEH2,NEI2
Gene ID 252969
NCBI Accession NP_659480, NM_145043
Pathways DNA Damage Repair
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions For Research Use only
Format Liquid
Buffer No additive
Preservative Without preservative
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Nei Endonuclease VIII-Like 2 (E. Coli) (NEIL2) (AA 1-332) antibody (ABIN531425) Western Blot analysis of NEIL2 expression in transfected 293T cell line by NEIL2 MaxP...