GUCY1B3 antibody

Catalog No. ABIN5514836

Product Details anti-GUCY1B3 Antibody

Target: GUCY1B3 (Guanylate Cyclase 1, Soluble, beta 3 (GUCY1B3))

Reactivity: Human, Mouse, Rat, Dog, Cow, Guinea Pig, Rabbit, Zebrafish (Danio rerio), Horse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GUCY1B3 antibody is un-conjugated

Application: Please inquire

Sequence: VTGVIGQRMP RYCLFGNTVN LTSRTETTGE KGKINVSEYT YRCLMSPENS

Predicted Reactivity: Cow: 100%, Dog: 100%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 100%, Rabbit: 100%, Rat: 100%, Zebrafish: 100%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence VTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENS

Application Details

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: -20 °C

Storage Comment: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Target Details for GUCY1B3

Target: GUCY1B3 (Guanylate Cyclase 1, Soluble, beta 3 (GUCY1B3))

Alternative Name: GUCY1B3 (GUCY1B3 Products)

Synonyms: GUCY1B3 antibody, AMGC1 antibody, AmsGC-beta1 antibody, AmsGCbeta1 antibody, GB20021 antibody, Gucy1b3 antibody, gucy1b3 antibody, GC-S-beta-1 antibody, GC-SB3 antibody, GUC1B3 antibody, GUCB3 antibody, GUCSB3 antibody, GUCY1B1 antibody, SGCB1 antibody, GCbeta1 antibody, Gucy1b1 antibody, SGC antibody, guanylate cyclase 1 soluble subunit beta antibody, guanylate cyclase 1, soluble, beta 3 antibody, guanylate cyclase, soluble, beta 1 antibody, guanylate cyclase 1, soluble, beta 3 S homeolog antibody, guanylate cyclase 1 soluble subunit beta 3 antibody, GUCY1B3 antibody, gucy1b3 antibody, Gycbeta1 antibody, gucy1b3.S antibody, Gucy1b3 antibody

Background: Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha subunit and a beta subunit, typically GUCY1B3, catalyzes conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide (NO) and nitrovasodilator drugs (Zabel et al., 1998 [PubMed 9742212]).[supplied by OMIM, Mar 2008]

Alias Symbols: GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B1, GC-S-beta-1,

Protein Interaction Partner: APP, STUB1, UBC, AGAP1, GUCY1A2, HSP90AA1, NOS3,

Protein Size: 619

Gene ID: 2983

NCBI Accession: NM_000857, NP_000848

UniProt: Q02153

Pathways: Transition Metal Ion Homeostasis