ABCC1 antibody (C-Term)

Catalog No. ABIN5518718

Product Details anti-ABCC1 Antibody

Target: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Binding Specificity: AA 1493-1528, C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCC1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Multidrug resistance-associated protein 1(ABCC1) detection. Tested with WB in Human.

Sequence: DYTRVIVLDK GEIQEYGAPS DLLQQRGLFY SMAKDA

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Multidrug resistance-associated protein 1(ABCC1) detection. Tested with WB in Human.
Gene Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 1
Protein Name: Multidrug resistance-associated protein 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MRP1 (1493-1528aa DYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAKDA), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-ABCC1 antibody (ABIN5518718)

Duan, Di: "Acetazolamide Suppresses Multi-Drug Resistance-Related Protein 1 and P-Glycoprotein Expression by Inhibiting Aquaporins Expression in a Mesial Temporal Epilepsy Rat Model." in: Medical science monitor : international medical journal of experimental and clinical research, Vol. 23, pp. 5818-5825, (2018) (PubMed).

Chen, Wei, Cheng, Xie, Wang, Yi, Tian, Liu, Wang, Zhang: "Characteristics of doxorubicin-selected multidrug-resistant human leukemia HL-60 cells with tolerance to arsenic trioxide and contribution of leukemia stem cells." in: Oncology letters, Vol. 15, Issue 1, pp. 1255-1262, (2018) (PubMed).

Gao, Xu, Qiu: "Enhanced combination therapy effect on paclitaxel-resistant carcinoma by chloroquine co-delivery via liposomes." in: International journal of nanomedicine, Vol. 10, pp. 6615-32, (2016) (PubMed).

Zhang, Yang, Wang, Liu, Wang, Xie, Chen, Dong, Li: "Enhanced autophagy reveals vulnerability of P-gp mediated epirubicin resistance in triple negative breast cancer cells." in: Apoptosis : an international journal on programmed cell death, Vol. 21, Issue 4, pp. 473-88, (2016) (PubMed).

Target Details for ABCC1

Target: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Alternative Name: ABCC1 (ABCC1 Products)

Synonyms: ABC29 antibody, ABCC antibody, GS-X antibody, MRP antibody, MRP1 antibody, Abcc1a antibody, Abcc1b antibody, Mdrap antibody, Mrp1 antibody, Avcc1a antibody, Mrp antibody, ABCC13 antibody, ATP binding cassette subfamily C member 1 antibody, ATP-binding cassette, sub-family C (CFTR/MRP), member 1 antibody, multidrug resistance-associated protein 1 antibody, ABCC1 antibody, Abcc1 antibody, LOC100152428 antibody, LOC100346553 antibody

Background: Multidrug resistance-associated protein 1 (MRP1) is a protein that in humans is encoded by the ABCC1 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternatively spliced variants of this gene have been described but their full-length nature is unknown.

Synonyms: ABCC1 | Leukotriene C transporter | Leukotriene C(4) transporter | LTC4 transporter | MRP | MRP1 | MRP-1 | P33527

Gene ID: 4363

UniProt: P33527

Pathways: SARS-CoV-2 Protein Interactome